PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000601-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 283aa    MW: 32117.4 Da    PI: 9.6137
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000601-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed ll+++++ +G g+W++ +++ g+ R++k+c++rw +yl
    NNU_000601-RA 14 RGPWTAREDTLLIKYIQAHGEGHWRSLPKKAGLLRCGKSCRLRWMNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding53.36.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE++l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
    NNU_000601-RA  67 RGNISPEEEDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.274961IPR017930Myb domain
SuperFamilySSF466895.99E-3011108IPR009057Homeodomain-like
SMARTSM007175.2E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-231568IPR009057Homeodomain-like
CDDcd001675.99E-101661No hitNo description
PROSITE profilePS5129425.21162116IPR017930Myb domain
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2669115IPR009057Homeodomain-like
CDDcd001679.75E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGRAPCCSKV GLHRGPWTAR EDTLLIKYIQ AHGEGHWRSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI SPEEEDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLSKRFKSQG  120
TDSNAKTKAA KRSTGEPKKR KSNNQQKKKK SIGRGNNDQE TTKTKIHLPK PVRITSLPIS  180
RNNSFEYNTP LSLQGGEKGV VVYTEDLELP WPYLRDGATT LIEGDQDHNL VVGGCDLGCQ  240
SQIPVKDNGM LEKLYEEYLQ LINTDTEEDH QAELDSFAES LWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252819.10.0PREDICTED: myb-related protein 308-like
SwissprotQ388503e-65MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A061DUF41e-120A0A061DUF4_THECC; Myb domain protein 7, putative
STRINGVIT_15s0046g00170.t011e-113(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.16e-65myb domain protein 3